Structure of PDB 2hdp Chain B

Receptor sequence

>2hdpB (length=63) Species: 9606 (Homo sapiens)

SLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVC
RQPIQMIVLTYFP

3D structure

• PDB: 2hdp Solution structure of the Hdm2 C2H2C4 RING, a domain critical for ubiquitination of p53.
• Chain: B
• Resolution: N/A

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C438 C441 C464	C10 C13 C36
BS02	ZN	B	H452 H457 C475 C478	H24 H29 C47 C50

Gene Ontology

Molecular Function

• GO:0042802 identical protein binding
• GO:0061630 ubiquitin protein ligase activity

Biological Process

• GO:0043066 negative regulation of apoptotic process
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:2hdp, PDBe:2hdp, PDBj:2hdp
• PDBsum: 2hdp
• PubMed: 16965791
• UniProt: Q00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)