Structure of PDB 2hdd Chain B

Receptor sequence
>2hddB (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKN
KRAKIK
3D structure
PDB2hdd Engrailed (Gln50-->Lys) homeodomain-DNA complex at 1.9 A resolution: structural basis for enhanced affinity and altered specificity.
ChainB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B Y25 R31 K46 K50 R53 K57 Y24 R30 K45 K49 R52 K56 PDBbind-CN: Kd=8.8pM
BS02 dna B K2 R3 I47 N51 K1 R2 I46 N50 PDBbind-CN: Kd=8.8pM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2hdd, PDBe:2hdd, PDBj:2hdd
PDBsum2hdd
PubMed9309220
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]