Structure of PDB 2hba Chain B |
>2hbaB (length=52) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] |
MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQ KQ |
|
PDB | 2hba Energetically significant networks of coupled interactions within an unfolded protein. |
Chain | B |
Resolution | 1.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
M1 D23 |
M1 D23 |
|
|
|
|