Structure of PDB 2h9c Chain B |
>2h9cB (length=85) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFPAPERVAAM LPERARWAEENGLDAPFVEGLFAQIIHWYIAEQIK |
|
PDB | 2h9c Two Crystal Structures of the Isochorismate Pyruvate Lyase from Pseudomonas aeruginosa. |
Chain | B |
Resolution | 2.35 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NO3 |
B |
R31 M57 |
R31 M50 |
|
|
|
|