Structure of PDB 2h5n Chain B |
>2h5nB (length=122) Species: 837 (Porphyromonas gingivalis) [Search protein sequence] |
IMTFSGQELTAIIKMAKSMVMADGKIKPAEIAVMTREFMRFGILQDQVDL LLKASDSIEASQAVALIARMDEERKKYVASYLGVIMASDGDIDDNELALW TLISTLCGLPTMTVMEAINNMK |
|
PDB | 2h5n Crystal structure of hypothetical protein PG_1108 from Porphyromonas gingivalis W83 |
Chain | B |
Resolution | 2.01 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
V29 D32 K34 |
V20 D23 K25 |
|
|
|
|