Structure of PDB 2h2k Chain B

Receptor sequence

>2h2kB (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]

AEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKD
VGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKI

3D structure

PDB

2h2k Crystal structure study on human S100A13 at 2.0 A resolution

Chain

Resolution

2.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	A24 E27 R29 S32 E37	A22 E25 R27 S30 E35
BS02	CA	B	D64 N66 D68 E70 E75	D62 N64 D66 E68 E73

Gene Ontology

	Molecular Function
GO:0005507	copper ion binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0008289	lipid binding
GO:0017134	fibroblast growth factor binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0001819	positive regulation of cytokine production
GO:0008284	positive regulation of cell population proliferation
GO:0015031	protein transport
GO:0032730	positive regulation of interleukin-1 alpha production
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0043303	mast cell degranulation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0048471	perinuclear region of cytoplasm

External links

PDB	RCSB:2h2k, PDBe:2h2k, PDBj:2h2k
PDBsum	2h2k
PubMed	17374362
UniProt	Q99584\|S10AD_HUMAN Protein S100-A13 (Gene Name=S100A13)