Structure of PDB 2h28 Chain B |
>2h28B (length=104) Species: 562 (Escherichia coli) [Search protein sequence] |
HDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQ AFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAV YPTP |
|
PDB | 2h28 Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems. |
Chain | B |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
W19 G21 |
W5 G7 |
|
|
|
|