Structure of PDB 2gvm Chain B |
>2gvmB (length=70) Species: 51453 (Trichoderma reesei) [Search protein sequence] |
NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQP LCCVAPVAGQALLCQTAVGA |
|
PDB | 2gvm Two crystal structures of Trichoderma reesei hydrophobin HFBI--The structure of a protein amphiphile with and without detergent interaction. |
Chain | B |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
D40 D43 |
D35 D38 |
|
|
|
|