Structure of PDB 2gmv Chain B

Receptor sequence

>2gmvB (length=602) Species: 9606 (Homo sapiens) [Search protein sequence]

NLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQ
MEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTG
LSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIE
LTDSPYVVASMRIMTRMGTPVLEALGDGEFVKCLHSVGCPLPLQKPLVNN
WPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEG
WLAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVG
DDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTN
VAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTP
ASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAA
MRSEAKIIMHDPFAMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWF
RKDKEGKFLWPGFGENSRVLEWMFNRIDGTKLTPIGYIPKEDALNLKGLG
HINMMELFSISKEFWDKEVEDIEKYLVDQVNADLPCEIEREILALKQRIS
QM

3D structure

PDB

2gmv C-8 Modifications of 3-alkyl-1,8-dibenzylxanthines as inhibitors of human cytosolic phosphoenolpyruvate carboxykinase.

Chain

Resolution

2.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	R87 Y235 K244 H264 S286 C288 D311 R405
Catalytic site (residue number reindexed from 1)	R78 Y226 K235 H255 S277 C279 D302 R396
Enzyme Commision number	2.7.11.- 4.1.1.32: phosphoenolpyruvate carboxykinase (GTP).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	B	K244 H264 D311	K235 H255 D302
BS02	PEP	B	A86 R87 Y235 G236 G237 R405	A77 R78 Y226 G227 G228 R396

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004611	phosphoenolpyruvate carboxykinase activity
GO:0004613	phosphoenolpyruvate carboxykinase (GTP) activity
GO:0005525	GTP binding
GO:0016301	kinase activity
GO:0016831	carboxy-lyase activity
GO:0017076	purine nucleotide binding
GO:0019003	GDP binding
GO:0030145	manganese ion binding
GO:0031406	carboxylic acid binding
GO:0046872	metal ion binding
GO:0106264	protein serine kinase activity (using GTP as donor)

	Biological Process
GO:0006006	glucose metabolic process
GO:0006094	gluconeogenesis
GO:0006107	oxaloacetate metabolic process
GO:0006629	lipid metabolic process
GO:0009617	response to bacterium
GO:0014823	response to activity
GO:0016310	phosphorylation
GO:0018105	peptidyl-serine phosphorylation
GO:0019543	propionate catabolic process
GO:0031667	response to nutrient levels
GO:0032496	response to lipopolysaccharide
GO:0032868	response to insulin
GO:0032869	cellular response to insulin stimulus
GO:0033993	response to lipid
GO:0042593	glucose homeostasis
GO:0042594	response to starvation
GO:0043382	positive regulation of memory T cell differentiation
GO:0043648	dicarboxylic acid metabolic process
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0046166	glyceraldehyde-3-phosphate biosynthetic process
GO:0046327	glycerol biosynthetic process from pyruvate
GO:0046889	positive regulation of lipid biosynthetic process
GO:0046890	regulation of lipid biosynthetic process
GO:0051365	cellular response to potassium ion starvation
GO:0070365	hepatocyte differentiation
GO:0070741	response to interleukin-6
GO:0071300	cellular response to retinoic acid
GO:0071320	cellular response to cAMP
GO:0071332	cellular response to fructose stimulus
GO:0071333	cellular response to glucose stimulus
GO:0071347	cellular response to interleukin-1
GO:0071356	cellular response to tumor necrosis factor
GO:0071377	cellular response to glucagon stimulus
GO:0071456	cellular response to hypoxia
GO:0071474	cellular hyperosmotic response
GO:0071475	cellular hyperosmotic salinity response
GO:0071476	cellular hypotonic response
GO:0071477	cellular hypotonic salinity response
GO:0071549	cellular response to dexamethasone stimulus
GO:0072350	tricarboxylic acid metabolic process
GO:0097403	cellular response to raffinose
GO:1904628	cellular response to phorbol 13-acetate 12-myristate
GO:1904640	response to methionine

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2gmv, PDBe:2gmv, PDBj:2gmv
PDBsum	2gmv
PubMed	17532214
UniProt	P35558\|PCKGC_HUMAN Phosphoenolpyruvate carboxykinase, cytosolic [GTP] (Gene Name=PCK1)

[Back to BioLiP]