Structure of PDB 2gja Chain B

Receptor sequence

>2gjaB (length=161) Species: 469008 (Escherichia coli BL21(DE3))

HGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGM
PLHIIDTAGLREASDEVERIGIERAWQEIEQADRVLFMVDGTTTDAVDPA
EIWPEFIARLPAKLPITVVRNKADITGETLGMSEVNGHALIRLSARTGEG
VDVLRNHLKQS

3D structure

• PDB: 2gja Dimerisation-dependent GTPase reaction of MnmE: how potassium acts as GTPase-activating element.
• Chain: B
• Resolution: 1.85 Å

Enzymatic activity

• Enzyme Commision number: 3.6.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ALF	B	P225 N226 K229 A248 G249 T250 T251 G273	P11 N12 K15 A34 G35 T36 T37 G59
BS02	MG	B	S230 T251	S16 T37
BS03	GDP	B	N226 G228 K229 S230 S231 V244 T245 D246 N335 K336 D338 I339 S358 R360	N12 G14 K15 S16 S17 V30 T31 D32 N121 K122 D124 I125 S144 R146

Gene Ontology

Molecular Function

• GO:0005525 GTP binding

External links

• PDB: RCSB:2gja, PDBe:2gja, PDBj:2gja
• PDBsum: 2gja
• PubMed: 16763562
• UniProt: P25522|MNME_ECOLI tRNA modification GTPase MnmE (Gene Name=mnmE)