Structure of PDB 2gie Chain B

Receptor sequence

>2gieB (length=256) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSD
LTFKQYEYLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSI
ENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQT
CAKMIDNKEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYIN
WAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVK
PFKKYI

3D structure

• PDB: 2gie Alteration of Sequence Specificity of the Type II Restriction Endonuclease HincII through an Indirect Readout Mechanism.
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	G30 H31 Q109 N110 D127 K129 T130 R131 N132 K135 S136 A137 Q138 A139 P140 N141 S144 K147 A205 Q207	G29 H30 Q108 N109 D126 K128 T129 R130 N131 K134 S135 A136 Q137 A138 P139 N140 S143 K146 A204 Q206	PDBbind-CN: Kd=0.58nM
BS02	dna	B	Y77 L86 S90 G92 K93 K108 Q109 Q138 Y199 N201 A204	Y76 L85 S89 G91 K92 K107 Q108 Q137 Y198 N200 A203	PDBbind-CN: Kd=0.58nM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:2gie, PDBe:2gie, PDBj:2gie
• PDBsum: 2gie
• PubMed: 16675462
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)