Structure of PDB 2ggm Chain B

Receptor sequence
>2ggmB (length=144) Species: 9606 (Homo sapiens) [Search protein sequence]
LTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMIS
EIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFK
NLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKK
3D structure
PDB2ggm The structure of the human centrin 2-xeroderma pigmentosum group C protein complex.
ChainB
Resolution2.35 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A56
Catalytic site (residue number reindexed from 1) A32
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B K108 L112 F113 L126 E132 L133 M145 M166 K84 L88 F89 L102 E108 L109 M121 M142
BS02 CA B D114 D116 T118 K120 N125 D90 D92 T94 K96 N101
BS03 CA B D150 D152 D154 E156 E161 D126 D128 D130 E132 E137
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0032795 heterotrimeric G-protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0007099 centriole replication
GO:0007283 spermatogenesis
GO:0015031 protein transport
GO:0032465 regulation of cytokinesis
GO:0051028 mRNA transport
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005814 centriole
GO:0005815 microtubule organizing center
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0032391 photoreceptor connecting cilium
GO:0036064 ciliary basal body
GO:0044615 nuclear pore nuclear basket
GO:0045177 apical part of cell
GO:0070390 transcription export complex 2
GO:0071942 XPC complex
GO:0097729 9+2 motile cilium

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ggm, PDBe:2ggm, PDBj:2ggm
PDBsum2ggm
PubMed16627479
UniProtP41208|CETN2_HUMAN Centrin-2 (Gene Name=CETN2)

[Back to BioLiP]