Structure of PDB 2gao Chain B

Receptor sequence

>2gaoB (length=171) Species: 9606 (Homo sapiens) [Search protein sequence]

SVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKVPTLHPTSEELTIAGMT
FTTFDLRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNV
PILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFM
CSVLKRQGYGEGFRWLSQYID

3D structure

PDB

2gao Crystal Structure of Human SAR1a in Complex With GDP

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	B	D34 N35 G37 K38 T39 T40 H58 N134 K135 D137 R138 S179 L181	D21 N22 G24 K25 T26 T27 H38 N107 K108 D110 R111 S152 L154

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0140785	amino acid sensor activity

	Biological Process
GO:0003400	regulation of COPII vesicle coating
GO:0006886	intracellular protein transport
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0015031	protein transport
GO:0016050	vesicle organization
GO:0016192	vesicle-mediated transport
GO:0042953	lipoprotein transport
GO:0048208	COPII vesicle coating
GO:0061024	membrane organization
GO:0070863	positive regulation of protein exit from endoplasmic reticulum
GO:0090110	COPII-coated vesicle cargo loading
GO:1903432	regulation of TORC1 signaling
GO:1904262	negative regulation of TORC1 signaling
GO:1990253	cellular response to leucine starvation

	Cellular Component
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0016020	membrane
GO:0030127	COPII vesicle coat
GO:0032580	Golgi cisterna membrane
GO:0070971	endoplasmic reticulum exit site

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2gao, PDBe:2gao, PDBj:2gao
PDBsum	2gao
PubMed
UniProt	Q9NR31\|SAR1A_HUMAN Small COPII coat GTPase SAR1A (Gene Name=SAR1A)

[Back to BioLiP]