Structure of PDB 2g83 Chain B

Receptor sequence

>2g83B (length=303) Species: 9606 (Homo sapiens)

EVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSII
AIIRAMGRLKIDFGDSARADDARQLFVLAELAGVIKRLWKDSGVQACFNR
SREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFK
DLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNR
MHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAG
SNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDV
IIK

3D structure

• PDB: 2g83 Minimal Determinants for Binding Activated Galpha from the Structure of a Galpha(i1)-Peptide Dimer.
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E43 T48 R178 D200 Q204
• Catalytic site (residue number reindexed from 1): E11 T16 R136 D158 Q162

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	R205 R208 F215 E245 K248 S252	R163 R166 F173 E203 K206 S210
BS02	ALF	B	G42 E43 R178 T181 Q204	G10 E11 R136 T139 Q162
BS03	MG	B	S47 T181	S15 T139
BS04	GDP	B	E43 G45 K46 S47 T48 R176 R178 K270 D272 C325 T327	E11 G13 K14 S15 T16 R134 R136 K228 D230 C283 T285

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0019001 guanyl nucleotide binding
• GO:0031683 G-protein beta/gamma-subunit complex binding

Biological Process

• GO:0007165 signal transduction
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway

External links

• PDB: RCSB:2g83, PDBe:2g83, PDBj:2g83
• PDBsum: 2g83
• PubMed: 16981699
• UniProt: P63096|GNAI1_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-1 (Gene Name=GNAI1)