Structure of PDB 2fxd Chain B |
>2fxdB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPIVTVKIGGQLKEALLDTGADDTVIEEMNLPGKWKPKIIGGI GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPFNVIGRNLMTQIGATLNF |
|
PDB | 2fxd X-ray crystal structures of human immunodeficiency virus type 1 protease mutants complexed with atazanavir. |
Chain | B |
Resolution | 1.6 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
3.1.26.13: retroviral ribonuclease H. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
DR7 |
B |
D25 G27 D29 G48 |
D25 G27 D29 G48 |
|
|
|
|