Structure of PDB 2fu5 Chain B |
>2fu5B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] |
QGHMVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKDGDLLQ EHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVA LERVSHE |
|
PDB | 2fu5 Nucleotide exchange via local protein unfolding-structure of Rab8 in complex with MSS4 |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C23 C26 C94 C97 |
C17 C20 C78 C81 |
|
|
|
|