Structure of PDB 2foi Chain B

Receptor sequence

>2foiB (length=229) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

EDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGK
FDNDMIIDKDKKMNILDMLPFDASFDTANDIDEETKNNKRYNMLQNYTIE
DVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSKSSYSLI
SLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLA
YHLGRNYNIRINTISAGPLKSRAATAINK

3D structure

PDB

2foi X-ray Structural Analysis of Plasmodium falciparum Enoyl Acyl Carrier Protein Reductase as a Pathway toward the Optimization of Triclosan Antimalarial Efficacy.

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y277 K285
Catalytic site (residue number reindexed from 1)	Y181 K189
Enzyme Commision number	1.3.1.9: enoyl-[acyl-carrier-protein] reductase (NADH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	B	G104 G106 G110 Y111 W131 F167 D168 A169 S215 L216 A217 N218 L265 T266 Y267 K285 A312 P314 L315 S317 A319	G8 G10 G14 Y15 W35 F71 D72 A73 S119 L120 A121 N122 L169 T170 Y171 K189 A216 P218 L219 S221 A223
BS02	JPA	B	A217 N218 A219 V222 Y267 Y277 P314 A319 A320	A121 N122 A123 V126 Y171 Y181 P218 A223 A224	MOAD: ic50=440nM

Gene Ontology

	Molecular Function
GO:0004318	enoyl-[acyl-carrier-protein] reductase (NADH) activity

	Biological Process
GO:0006633	fatty acid biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2foi, PDBe:2foi, PDBj:2foi
PDBsum	2foi
PubMed	17567585
UniProt	C6KSZ2

[Back to BioLiP]