Structure of PDB 2fnu Chain B

Receptor sequence

>2fnuB (length=374) Species: 85962 (Helicobacter pylori 26695)

MKEFAYSEPCLDKEDKKAVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHA
LVFNSATSALLTLYRNFSEFSADRNEIITTPISFVATANMLLESGYTPVF
AGIKNDGNIDELALEKLINERTKAIVSVDYAGKSVEVESVQKLCKKHSLS
FLSDSSHALGSEYQNKKVGGFALASVFSFHAIKPITTAEGGAVVTNDSEL
HEKMKLFRSHGMLKKDFFEGEVKSIGHNFRLNEIQSALGLSQLKKAPFLM
QKREEAALTYDRIFKDNPYFTPLHPLLKDKSSNHLYPILMHQKFFTCKKL
ILESLHKRGILAQVHYKPIYQYQLYQQLFNTAPLKSAEDFYHAEISLPCH
ANLNLESVQNIAHSVLKTFESFKI

3D structure

• PDB: 2fnu Structural and Functional Characterization of PseC, an Aminotransferase Involved in the Biosynthesis of Pseudaminic Acid, an Essential Flagellar Modification in Helicobacter pylori
• Chain: B
• Resolution: 1.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): F84 D154 H157 H180 K183 K214 G220 R230
• Catalytic site (residue number reindexed from 1): F84 D154 H157 H180 K183 K214 G220 R230
• Enzyme Commision number: 2.6.1.92: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UD1	B	K26 Q27 L28 T29	K26 Q27 L28 T29
BS02	PMP	B	A56 T57 F84 D154 S156 H157 S178	A56 T57 F84 D154 S156 H157 S178
BS03	UD1	B	Y6 P9 F84 H180 A181 I182 Q313 H315 Y316	Y6 P9 F84 H180 A181 I182 Q313 H315 Y316

Gene Ontology

Molecular Function

• GO:0008483 transaminase activity
• GO:0030170 pyridoxal phosphate binding

Biological Process

• GO:0000271 polysaccharide biosynthetic process

External links

• PDB: RCSB:2fnu, PDBe:2fnu, PDBj:2fnu
• PDBsum: 2fnu
• PubMed: 16421095
• UniProt: O25130|PSEC_HELPY UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase (Gene Name=pseC)