Structure of PDB 2fbw Chain B

Receptor sequence

>2fbwB (length=240) Species: 9031 (Gallus gallus)

TSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDS
TLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYV
VKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYE
CILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQ
DPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE

3D structure

• PDB: 2fbw 3-nitropropionic acid is a suicide inhibitor of mitochondrial respiration that, upon oxidation by complex II, forms a covalent adduct with a catalytic base arginine in the active site of the enzyme.
• Chain: B
• Resolution: 2.06 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	B	C65 R66 G68 C70 G71 S72 C73 C85	C58 R59 G61 C63 G64 S65 C66 C78
BS02	SF4	B	C158 I159 L160 C161 C164 A182 C225 P226	C151 I152 L153 C154 C157 A175 C218 P219
BS03	F3S	B	C168 Y178 P181 C215 T217 I218 M219 N220 C221	C161 Y171 P174 C208 T210 I211 M212 N213 C214
BS04	CBE	B	P169 W173 H216	P162 W166 H209

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle

External links

• PDB: RCSB:2fbw, PDBe:2fbw, PDBj:2fbw
• PDBsum: 2fbw
• PubMed: 16371358
• UniProt: Q9YHT2|SDHB_CHICK Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (Gene Name=SDHB)