Structure of PDB 2fbr Chain B |
>2fbrB (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA LLSPYSYSTTAVVT |
|
PDB | 2fbr Synthesis and characterization of potent bivalent amyloidosis inhibitors that bind prior to transthyretin tetramerization. |
Chain | B |
Resolution | 1.46 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
44C |
B |
K15 L17 A108 S117 |
K6 L8 A99 S108 |
|
|
|
|