Structure of PDB 2fac Chain B

Receptor sequence

>2facB (length=77) Species: 562 (Escherichia coli)

STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEF
DTEIPDEEAEKITTVQAAIDYINGHQA

3D structure

• PDB: 2fac Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates.
• Chain: B
• Resolution: 1.76 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D35
• Catalytic site (residue number reindexed from 1): D35

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PM4	B	F28 S36 T39 V43 L46 E47 T52 I54 A59 I62 I72	F28 S36 T39 V43 L46 E47 T52 I54 A59 I62 I72

Gene Ontology

Molecular Function

• GO:0000035 acyl binding
• GO:0000036 acyl carrier activity
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0031177 phosphopantetheine binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0009245 lipid A biosynthetic process
• GO:0009410 response to xenobiotic stimulus

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2fac, PDBe:2fac, PDBj:2fac
• PDBsum: 2fac
• PubMed: 17059829
• UniProt: P0A6A8|ACP_ECOLI Acyl carrier protein (Gene Name=acpP)