Structure of PDB 2f9j Chain B

Receptor sequence
>2f9jB (length=114) Species: 9606 (Homo sapiens) [Search protein sequence]
RLPPEVNRILMIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAY
VVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLK
LLKEKYGINTDPPK
3D structure
PDB2f9j Crystal structure of a core spliceosomal protein interface
ChainB
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B L13 P14 P15 V17 R19 I20 A32 R46 Q47 I48 R49 V50 G51 N52 T56 T59 Y61 D66 I67 Y92 A97 F98 L113 Y117 L2 P3 P4 V6 R8 I9 A21 R35 Q36 I37 R38 V39 G40 N41 T45 T48 Y50 D55 I56 Y81 A86 F87 L102 Y106
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0001825 blastocyst formation
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2f9j, PDBe:2f9j, PDBj:2f9j
PDBsum2f9j
PubMed16432215
UniProtQ9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 (Gene Name=SF3B6)

[Back to BioLiP]