Structure of PDB 2f2o Chain B

Receptor sequence

>2f2oB (length=159) Species: 9913 (Bos taurus)

LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAA
ELRHVMTNLGEVDEMIREADIDGDGQVNYEEFVQMMTAARKEVIRNKIRA
IGKMARVFS

3D structure

• PDB: 2f2o Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
• Chain: B
• Resolution: 2.17 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V35
• Catalytic site (residue number reindexed from 1): V32
• Enzyme Commision number:
  3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	D20 D22 D24 T26 E31	D17 D19 D21 T23 E28
BS02	CA	B	D56 D58 N60 T62 E67	D53 D55 N57 T59 E64
BS03	CA	B	D93 D95 N97 Y99 E104	D90 D92 N94 Y96 E101
BS04	CA	B	D129 D131 D133 Q135 E140	D120 D122 D124 Q126 E131

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0046872 metal ion binding

Biological Process

• GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
• GO:0060315 negative regulation of ryanodine-sensitive calcium-release channel activity
• GO:0060316 positive regulation of ryanodine-sensitive calcium-release channel activity

Cellular Component

• GO:0000922 spindle pole
• GO:0005737 cytoplasm
• GO:0005819 spindle
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:2f2o, PDBe:2f2o, PDBj:2f2o
• PDBsum: 2f2o
• PubMed: 16411749
• UniProt: P48452|PP2BA_BOVIN Protein phosphatase 3 catalytic subunit alpha (Gene Name=PPP3CA);
  P62157|CALM_BOVIN Calmodulin (Gene Name=CALM)