Structure of PDB 2er8 Chain B

Receptor sequence
>2er8B (length=67) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RKFACVECRQQKSKCDAHERAPEPCTKCAKKNVPCILKRDFRRTYKRARN
EAIEKRFKELTRTLTNL
3D structure
PDB2er8 Structure of a Leu3-DNA complex: recognition of everted CGG half-sites by a Zn2Cys6 binuclear cluster protein.
ChainB
Resolution2.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R33 Q43 K44 R75 Y77 K78 R79 R1 Q11 K12 R43 Y45 K46 R47
BS02 dna B F35 A36 R41 K44 K46 C47 R74 F3 A4 R9 K12 K14 C15 R42
BS03 ZN B C37 C57 C60 C67 C5 C25 C28 C35
BS04 ZN B C37 C40 C47 C57 C5 C8 C15 C25
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2er8, PDBe:2er8, PDBj:2er8
PDBsum2er8
PubMed16615914
UniProtP08638|LEUR_YEAST Regulatory protein LEU3 (Gene Name=LEU3)

[Back to BioLiP]