Structure of PDB 2ej0 Chain B

Receptor sequence

>2ej0B (length=305) Species: 300852 (Thermus thermophilus HB8)

QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIF
RLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAW
MGAKALGVNPLPNNPAEVMVAAWEWGAYLGEEAVRKGARLITSSWARFPA
NVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFF
VRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEV
FMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGW
LTYVN

3D structure

• PDB: 2ej0 Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase with Pyridoxamine 5'-phosphate
• Chain: B
• Resolution: 1.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): F36 G38 K159 E193 L216
• Catalytic site (residue number reindexed from 1): F35 G37 K158 E192 L215
• Enzyme Commision number: 2.6.1.42: branched-chain-amino-acid transaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PMP	B	R59 Y164 E193 G196 E197 L216 G218 I219 T220 G255 T256	R58 Y163 E192 G195 E196 L215 G217 I218 T219 G254 T255

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004084 branched-chain-amino-acid transaminase activity
• GO:0008483 transaminase activity
• GO:0052654 L-leucine-2-oxoglutarate transaminase activity
• GO:0052655 L-valine-2-oxoglutarate transaminase activity
• GO:0052656 L-isoleucine-2-oxoglutarate transaminase activity

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009081 branched-chain amino acid metabolic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009098 L-leucine biosynthetic process
• GO:0009099 L-valine biosynthetic process
• GO:0019752 carboxylic acid metabolic process
• GO:0046394 carboxylic acid biosynthetic process

External links

• PDB: RCSB:2ej0, PDBe:2ej0, PDBj:2ej0
• PDBsum: 2ej0
• UniProt: Q5SM19