Structure of PDB 2egd Chain B

Receptor sequence
>2egdB (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
LTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGS
LDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIR
3D structure
PDB2egd Crystal structure of human S100A13 in the Ca2+-bound state
ChainB
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA B A24 E27 R29 S32 E37 A19 E22 R24 S27 E32
BS02 CA B D64 N66 D68 E70 E75 D59 N61 D63 E65 E70
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0008289 lipid binding
GO:0017134 fibroblast growth factor binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
Biological Process
GO:0001819 positive regulation of cytokine production
GO:0008284 positive regulation of cell population proliferation
GO:0015031 protein transport
GO:0032730 positive regulation of interleukin-1 alpha production
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043303 mast cell degranulation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2egd, PDBe:2egd, PDBj:2egd
PDBsum2egd
PubMed18259052
UniProtQ99584|S10AD_HUMAN Protein S100-A13 (Gene Name=S100A13)

[Back to BioLiP]