Structure of PDB 2efc Chain B

Receptor sequence
>2efcB (length=165) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
SINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDA
TVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQE
LQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTA
TNVKEIFYEIARRLP
3D structure
PDB2efc GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
ChainB
Resolution2.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP B G20 G22 K23 S24 S25 N123 K124 D126 S153 K155 G13 G15 K16 S17 S18 N116 K117 D119 S146 K148
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0036094 small molecule binding
GO:0140313 molecular sequestering activity
Biological Process
GO:0006886 intracellular protein transport
GO:0007033 vacuole organization
GO:0015031 protein transport
GO:0045324 late endosome to vacuole transport
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0031901 early endosome membrane
GO:0032585 multivesicular body membrane
GO:0043229 intracellular organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2efc, PDBe:2efc, PDBj:2efc
PDBsum2efc
PubMed20833725
UniProtQ9SN68|RAF2B_ARATH Ras-related protein RABF2b (Gene Name=RABF2B)

[Back to BioLiP]