Structure of PDB 2ed4 Chain B

Receptor sequence
>2ed4B (length=149) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKEAFKEALARFASGVTVVAARLGEEERGMTATAFMSLSLEPPLVALAVS
ERAKLLPVLEGAGAFTVSLLREGQEAVSEHFAGRPKEGIALEEGRVKGAL
AVLRCRLHALYPGGDHRIVVGLVEEVELGEGGPPLVYFQRGYRRLVWPS
3D structure
PDB2ed4 Crystal structure of the flavin reductase component (HpaC) of 4-hydroxyphenylacetate 3-monooxygenase from Thermus thermophilus HB8: Structural basis for the flavin affinity
ChainB
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.5.1.36: flavin reductase (NADH).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FAD B E27 R28 G29 M30 T31 A32 T33 A34 V49 S50 A53 K54 L55 H80 F81 A82 Y137 E27 R28 G29 M30 T31 A32 T33 A34 V49 S50 A53 K54 L55 H80 F81 A82 Y137
BS02 NAD B L9 H116 Y137 R140 L9 H116 Y137 R140
Gene Ontology
Molecular Function
GO:0010181 FMN binding
GO:0016491 oxidoreductase activity
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
GO:0036382 flavin reductase (NADH) activity
GO:0042602 riboflavin reductase (NADPH) activity
Biological Process
GO:0006208 pyrimidine nucleobase catabolic process
GO:0009056 catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ed4, PDBe:2ed4, PDBj:2ed4
PDBsum2ed4
PubMed17729270
UniProtQ5SJP7|HPAC_THET8 4-hydroxyphenylacetate 3-monooxygenase, reductase component (Gene Name=TTHA0961)

[Back to BioLiP]