Structure of PDB 2eck Chain B

Receptor sequence
>2eckB (length=214) Species: 562 (Escherichia coli) [Search protein sequence]
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAK
DIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAG
INVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTG
EELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTK
PVAEVRADLEKILG
3D structure
PDB2eck Crystal structure of ADP/AMP complex of Escherichia coli adenylate kinase.
ChainB
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K13 R88 R123 R156 R167
Catalytic site (residue number reindexed from 1) K13 R88 R123 R156 R167
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AMP B T31 L35 R36 M53 K57 V59 R88 Q92 R156 T31 L35 R36 M53 K57 V59 R88 Q92 R156
BS02 ADP B G10 G12 K13 G14 T15 R119 R123 Y133 H134 F137 K200 V202 G10 G12 K13 G14 T15 R119 R123 Y133 H134 F137 K200 V202
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004017 adenylate kinase activity
GO:0004550 nucleoside diphosphate kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016208 AMP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
GO:0050145 nucleoside monophosphate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006172 ADP biosynthetic process
GO:0009123 nucleoside monophosphate metabolic process
GO:0009132 nucleoside diphosphate metabolic process
GO:0009165 nucleotide biosynthetic process
GO:0015951 purine ribonucleotide interconversion
GO:0016310 phosphorylation
GO:0044209 AMP salvage
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2eck, PDBe:2eck, PDBj:2eck
PDBsum2eck
PubMed16302237
UniProtP69441|KAD_ECOLI Adenylate kinase (Gene Name=adk)

[Back to BioLiP]