Structure of PDB 2e8w Chain B

Receptor sequence

>2e8wB (length=307) Species: 4932 (Saccharomyces cerevisiae)

NKMEAKIDELINNDPVWSSQNESLISKPYNHILLKPGKNFRLNLIVQINR
VMNLPKDQLAIVSQIVELLHNSSLLIDDIEDNAPLRRGQTTSHLIFGVPS
TINTANYMYFRAMQLVSQLTTKEPLYHNLITIFNEELINLHRGQGLDIYW
RDFLPEIIPTQEMYLNMVMNKTGGLFRLTLRLMEALSPSSHHGHSLVPFI
NLLGIIYQIRDDYLNLKDFQMSFAEDITEGKLSFPIVHALNFTKTKGQTE
QHNEILRILLLRTSDKDIKLKLIQILEFDTNSLAYTKNFINQLVNMIKND
NENKYLP

3D structure

• PDB: 2e8w Bisphosphonates target multiple sites in both cis- and trans-prenyltransferases
• Chain: B
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.-
  2.5.1.1: dimethylallyltranstransferase.
  2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
  2.5.1.29: geranylgeranyl diphosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	D80 D84	D77 D81
BS02	MG	B	D80 D84	D77 D81
BS03	IPE	B	S76 D80 R89 L143 K174 Q211 D214 K238	S73 D77 R86 L140 K171 Q208 D211 K231
BS04	IPE	B	K38 P39 H73 L77 R90 Y210 Q211 D214	K35 P36 H70 L74 R87 Y207 Q208 D211

Gene Ontology

Molecular Function

• GO:0004161 dimethylallyltranstransferase activity
• GO:0004311 farnesyltranstransferase activity
• GO:0004337 geranyltranstransferase activity
• GO:0004659 prenyltransferase activity
• GO:0016740 transferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008299 isoprenoid biosynthetic process
• GO:0015031 protein transport
• GO:0016114 terpenoid biosynthetic process
• GO:0033384 geranyl diphosphate biosynthetic process
• GO:0033386 geranylgeranyl diphosphate biosynthetic process
• GO:0045337 farnesyl diphosphate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:2e8w, PDBe:2e8w, PDBj:2e8w
• PDBsum: 2e8w
• PubMed: 17535895
• UniProt: Q12051|GGPPS_YEAST Geranylgeranyl pyrophosphate synthase BTS1 (Gene Name=BTS1)