Structure of PDB 2e7l Chain B |
>2e7lB (length=110) Species: 10090 (Mus musculus) [Search protein sequence] |
SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYS GDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSHQGRYLTF GSGTKVIVLP |
|
PDB | 2e7l How a single T cell receptor recognizes both self and foreign MHC. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
Y31 Q100 G101 |
Y30 Q94 G95 |
|
|
|