Structure of PDB 2e76 Chain B

Receptor sequence

>2e76B (length=160) Species: 83541 (Mastigocladus laminosus)

MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFAC
IVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLL
MASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFP
LDKTLTLGLF

3D structure

• PDB: 2e76 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
• Chain: B
• Resolution: 3.41 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E78
• Catalytic site (residue number reindexed from 1): E78

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D35 L57	D35 L57
BS02	HEM	B	F40 V43 I44	F40 V43 I44
BS03	CLA	B	V104 L108 I132 F133 G136 T140	V104 L108 I132 F133 G136 T140
BS04	TDS	B	I75 L76 P77 L81 F85 L88	I75 L76 P77 L81 F85 L88
BS05	TDS	B	L36 F40	L36 F40

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:2e76, PDBe:2e76, PDBj:2e76
• PDBsum: 2e76
• PubMed: 17498743
• UniProt: P83792|PETD_MASLA Cytochrome b6-f complex subunit 4 (Gene Name=petD)