Structure of PDB 2e75 Chain B

Receptor sequence

>2e75B (length=160) Species: 83541 (Mastigocladus laminosus)

MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFAC
IVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLL
MASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFP
LDKTLTLGLF

3D structure

• PDB: 2e75 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
• Chain: B
• Resolution: 3.55 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E78
• Catalytic site (residue number reindexed from 1): E78

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D35 C50 L57	D35 C50 L57
BS02	HEM	B	N25 F40	N25 F40
BS03	QNO	B	A31 L36 F40	A31 L36 F40
BS04	CLA	B	M101 V104 L108 F133 G136 T140	M101 V104 L108 F133 G136 T140

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:2e75, PDBe:2e75, PDBj:2e75
• PDBsum: 2e75
• PubMed: 17498743
• UniProt: P83792|PETD_MASLA Cytochrome b6-f complex subunit 4 (Gene Name=petD)