Structure of PDB 2e74 Chain B

Receptor sequence
>2e74B (length=160) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFAC
IVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLL
MASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFP
LDKTLTLGLF
3D structure
PDB2e74 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
ChainB
Resolution3.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E78
Catalytic site (residue number reindexed from 1) E78
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B C50 L57 C50 L57
BS02 HEM B F40 I44 F40 I44
BS03 CLA B Y80 V104 L108 I132 F133 G136 T140 Y80 V104 L108 I132 F133 G136 T140
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
Cellular Component
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2e74, PDBe:2e74, PDBj:2e74
PDBsum2e74
PubMed17498743
UniProtP83792|PETD_MASLA Cytochrome b6-f complex subunit 4 (Gene Name=petD)

[Back to BioLiP]