Structure of PDB 2e0i Chain B

Receptor sequence

>2e0iB (length=431) Species: 273063 (Sulfurisphaera tokodaii str. 7)

MDCIFIFRRDLRLEDNTGLNYALSECDRVIPVFIADPRQLINNPYKSEFA
VSFMINSLLELDDELRKKGSRLNVFFGEAEKVVSRFFNKVDAIYVNEDYT
PFSISRDEKIRKVCEENGIEFKAYEDYLLTPKSLFHHRNFTSFYNEVSKV
KVREPETMEGSFDVTDSSMNVDFLLTFKKIESPLFRGGRREGLYLLHRNV
DFRRRDYPAENNNYRLSPHLKFGTISMREAYYTQKGKEEFVRELYWRDFF
TLLAYYNPHVFGHCYRREYDNISWENNESYFEAWKEGRTGYPIIDAGMRM
LNSTGYINGRVRMLVAFFLVKVLFVDWRWGERYFATKLVDYDPAINNGNW
QWIASTGVDYMFRVFNPWKQQEKFDPEAKFIKEWVEELKDVPPSIIHSIY
KTKVPGYPSPIVNWLERVNYVKSEYKNVKAV

3D structure

• PDB: 2e0i Crystal Structure of Archaeal Photolyase from Sulfolobus tokodaii with Two FAD Molecules: Implication of a Novel Light-harvesting Cofactor
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E243 W246 W274 G309 W327 W350
• Catalytic site (residue number reindexed from 1): E243 W246 W274 G309 W327 W350
• Enzyme Commision number: 4.1.99.3: deoxyribodipyrimidine photo-lyase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	F202 N213 R215 S217 E243 W246 R247 Y306 G309 R312 M313 F334 D340 D342 I345 N346 N349	F202 N213 R215 S217 E243 W246 R247 Y306 G309 R312 M313 F334 D340 D342 I345 N346 N349
BS02	FAD	B	F33 I34 Q39 L40 N43 Y45 M54 D98 T100 F102 R106 Y341 P343	F33 I34 Q39 L40 N43 Y45 M54 D98 T100 F102 R106 Y341 P343

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003677 DNA binding
• GO:0003904 deoxyribodipyrimidine photo-lyase activity
• GO:0016829 lyase activity
• GO:0071949 FAD binding
• GO:0097159 organic cyclic compound binding

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0006950 response to stress

External links

• PDB: RCSB:2e0i, PDBe:2e0i, PDBj:2e0i
• PDBsum: 2e0i
• PubMed: 17107688
• UniProt: F9VNB1