Structure of PDB 2ds8 Chain B

Receptor sequence
>2ds8B (length=41) Species: 562 (Escherichia coli) [Search protein sequence]
KLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREE
3D structure
PDB2ds8 Structural Basis of SspB-tail Recognition by the Zinc Binding Domain of ClpX.
ChainB
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B Q21 V24 R25 K26 L27 I28 A29 Y34 Q12 V15 R16 K17 L18 I19 A20 Y25
BS02 ZN B C14 C17 C36 C39 C5 C8 C27 C30
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:2ds8, PDBe:2ds8, PDBj:2ds8
PDBsum2ds8
PubMed17258768
UniProtP0A6H1|CLPX_ECOLI ATP-dependent Clp protease ATP-binding subunit ClpX (Gene Name=clpX)

[Back to BioLiP]