Structure of PDB 2deu Chain B

Receptor sequence

>2deuB (length=364) Species: 562 (Escherichia coli)

AKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAAD
LADAQAVCDKLGIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNK
EIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSRLLRGLDSNKDQSYF
LYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGER
KFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEG
TEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTM
RCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVC
LGGGIIEQRLPLPV

3D structure

• PDB: 2deu Snapshots of tRNA sulphuration via an adenylated intermediate
• Chain: B
• Resolution: 3.4 Å

Enzymatic activity

• Enzyme Commision number: 2.8.1.13: tRNA-uridine 2-sulfurtransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	W23 I181 D184 L185	W19 I177 D180 L181
BS02	rna	B	Y90 T95 N97 P98 D99 H128 F154 T196 G197 F206 G241 Q242 R243 K244 G245 I248 G249 G250 E256 P258 Y260 R311 Y312 R313 Q344	Y86 T91 N93 P94 D95 H124 F150 T192 G193 F202 G237 Q238 R239 K240 G241 I244 G245 G246 E252 P254 Y256 R307 Y308 R309 Q340
BS03	AMP	B	G11 M12 S13 S18 F36 M37 T126 G127 H128	G7 M8 S9 S14 F32 M33 T122 G123 H124

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0005524 ATP binding
• GO:0016740 transferase activity
• GO:0016783 sulfurtransferase activity
• GO:0103016 tRNA-uridine 2-sulfurtransferase activity

Biological Process

• GO:0002143 tRNA wobble position uridine thiolation
• GO:0006400 tRNA modification
• GO:0008033 tRNA processing

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:1990228 sulfurtransferase complex

External links

• PDB: RCSB:2deu, PDBe:2deu, PDBj:2deu
• PDBsum: 2deu
• PubMed: 16871210
• UniProt: P25745|MNMA_ECOLI tRNA-specific 2-thiouridylase MnmA (Gene Name=mnmA)