Structure of PDB 2d5x Chain B

Receptor sequence
>2d5xB (length=146) Species: 9796 (Equus caballus) [Search protein sequence]
VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSN
PGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDP
ENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH
3D structure
PDB2d5x R-state haemoglobin with low oxygen affinity: crystal structures of deoxy human and carbonmonoxy horse haemoglobin bound to the effector molecule L35
ChainB
Resolution1.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B T38 F41 F42 H63 S70 F71 L88 H92 L96 V98 N102 F103 L106 L141 T38 F41 F42 H63 S70 F71 L88 H92 L96 V98 N102 F103 L106 L141
BS02 L35 B Y35 W37 L105 N108 Y35 W37 L105 N108
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0031721 hemoglobin alpha binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2d5x, PDBe:2d5x, PDBj:2d5x
PDBsum2d5x
PubMed16403522
UniProtP02062|HBB_HORSE Hemoglobin subunit beta (Gene Name=HBB)

[Back to BioLiP]