Structure of PDB 2d2m Chain B

Receptor sequence
>2d2mB (length=142) Species: 55676 (Oligobrachia mashikoi) [Search protein sequence]
DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVN
GNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIP
AAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISG
3D structure
PDB2d2m Structure of an extracellular giant hemoglobin of the gutless beard worm Oligobrachia mashikoi.
ChainB
Resolution2.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B L45 F46 R48 V49 H62 R65 V66 L70 Q93 H94 R97 I99 G103 Y104 F107 L45 F46 R48 V49 H62 R65 V66 L70 Q93 H94 R97 I99 G103 Y104 F107
BS02 OXY B W32 V66 W32 V66
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
Cellular Component
GO:0005576 extracellular region
GO:0005833 hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2d2m, PDBe:2d2m, PDBj:2d2m
PDBsum2d2m
PubMed16204001
UniProtQ7M413|GLBA2_OLIMA Extracellular giant hemoglobin major globin subunit A2 (Gene Name=ghbA2)

[Back to BioLiP]