Structure of PDB 2cth Chain B

Receptor sequence

>2cthB (length=107) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough)

APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAG
CHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGC
KKSKCHE

3D structure

• PDB: 2cth Structure Analysis of Cytochrome C3 from Desulfovibrio Vulgaris Hildenborough at 1.9 A Resolution
• Chain: B
• Resolution: 1.67 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	M11 E12 A13 T14 Q16 V18 Y65 Y66 H70 H83 T98 G99 C100 C105 H106	M11 E12 A13 T14 Q16 V18 Y65 Y66 H70 H83 T98 G99 C100 C105 H106
BS02	HEM	B	H35 R44 C46 C51 H52 H67 V68 T74 K75 F76	H35 R44 C46 C51 H52 H67 V68 T74 K75 F76
BS03	HEM	B	P2 P5 M11 F20 H22 H25 V28 C30 C33 H34 Y43 K45 C46	P2 P5 M11 F20 H22 H25 V28 C30 C33 H34 Y43 K45 C46
BS04	HEM	B	N21 T24 H25 C79 C82 H83 K93 K104	N21 T24 H25 C79 C82 H83 K93 K104

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2cth, PDBe:2cth, PDBj:2cth
• PDBsum: 2cth
• UniProt: P00131|CYC3_NITV2 Cytochrome c3 (Gene Name=DVU_3171)