Structure of PDB 2cb3 Chain B

Receptor sequence
>2cb3B (length=169) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
SAIIPRSSWLAQKPMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRD
MQSFHIESRGWNDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGIS
FIGCFMKELPTADALNMCRNLLARGVEDGHISTDYRLICHCQCNSTESPG
RRLYEEIQTWPHFYNIEEE
3D structure
PDB2cb3 Structural Basis for Preferential Recognition of Diaminopimelic Acid-Type Peptidoglycan by a Subset of Peptidoglycan Recognition Proteins
ChainB
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y240
Catalytic site (residue number reindexed from 1) Y66
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MLD B R223 S227 E231 R49 S53 E57 MOAD: Kd=27nM
BS02 MLD B H206 T207 H229 R233 W235 N236 Y240 R254 A261 H262 N267 H314 N318 T320 E321 S322 H32 T33 H55 R59 W61 N62 Y66 R80 A87 H88 N93 H140 N144 T146 E147 S148 MOAD: Kd=27nM
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
GO:0042834 peptidoglycan binding
Biological Process
GO:0009253 peptidoglycan catabolic process
GO:0045087 innate immune response

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2cb3, PDBe:2cb3, PDBj:2cb3
PDBsum2cb3
PubMed16428381
UniProtQ9VXN9|PGPLE_DROME Peptidoglycan-recognition protein LE (Gene Name=PGRP-LE)

[Back to BioLiP]