Structure of PDB 2c9o Chain B

Receptor sequence

>2c9oB (length=393) Species: 9606 (Homo sapiens) [Search protein sequence]

TTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKS
KKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKK
TEVLMENFRRAIGLRIKETKEVYEGEVTELTPCSHVIIGLKTAKGTKQLK
LDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYV
PLPKGDVHKKKEIIQDVTLHDLDINKVVNKYIDQGIAELVPGVLFVDEVH
MLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLL
DRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRY
SVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILA

3D structure

PDB

2c9o Crystal structure of the human AAA+ protein RuvBL1.

Chain

Resolution

2.2 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	K76 T77 D302 T345 R404
Catalytic site (residue number reindexed from 1)	K68 T69 D247 T290 R349
Enzyme Commision number	3.6.4.12: DNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	B	S17 H18 H20 L39 V40 G73 T74 G75 K76 T77 Y366 I374	S9 H10 H12 L31 V32 G65 T66 G67 K68 T69 Y311 I319

Gene Ontology

	Molecular Function
GO:0001094	TFIID-class transcription factor complex binding
GO:0003678	DNA helicase activity
GO:0003713	transcription coactivator activity
GO:0004386	helicase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008094	ATP-dependent activity, acting on DNA
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity
GO:0017025	TBP-class protein binding
GO:0043531	ADP binding
GO:0045296	cadherin binding
GO:0051117	ATPase binding

	Biological Process
GO:0000492	box C/D snoRNP assembly
GO:0000723	telomere maintenance
GO:0006275	regulation of DNA replication
GO:0006281	DNA repair
GO:0006282	regulation of DNA repair
GO:0006310	DNA recombination
GO:0006325	chromatin organization
GO:0006338	chromatin remodeling
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II
GO:0007283	spermatogenesis
GO:0032508	DNA duplex unwinding
GO:0033044	regulation of chromosome organization
GO:0042981	regulation of apoptotic process
GO:0045739	positive regulation of DNA repair
GO:0045893	positive regulation of DNA-templated transcription
GO:0045995	regulation of embryonic development
GO:0050821	protein stabilization
GO:0051276	chromosome organization
GO:0051301	cell division
GO:0051726	regulation of cell cycle
GO:0060382	regulation of DNA strand elongation
GO:0090263	positive regulation of canonical Wnt signaling pathway
GO:0090671	telomerase RNA localization to Cajal body
GO:1904507	positive regulation of telomere maintenance in response to DNA damage
GO:1905168	positive regulation of double-strand break repair via homologous recombination
GO:2000779	regulation of double-strand break repair

	Cellular Component
GO:0000786	nucleosome
GO:0000812	Swr1 complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0016020	membrane
GO:0016363	nuclear matrix
GO:0031011	Ino80 complex
GO:0035267	NuA4 histone acetyltransferase complex
GO:0070062	extracellular exosome
GO:0071339	MLL1 complex
GO:0097255	R2TP complex
GO:0101031	protein folding chaperone complex
GO:0120293	dynein axonemal particle
GO:1990062	RPAP3/R2TP/prefoldin-like complex
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2c9o, PDBe:2c9o, PDBj:2c9o
PDBsum	2c9o
PubMed	17060327
UniProt	Q9Y265\|RUVB1_HUMAN RuvB-like 1 (Gene Name=RUVBL1)

[Back to BioLiP]