Structure of PDB 2c92 Chain B

Receptor sequence
>2c92B (length=147) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
DASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIP
VVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIA
NGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
3D structure
PDB2c92 Structural and Thermodynamic Insights Into the Binding Mode of Five Novel Inhibitors of Lumazine Synthase from Mycobacterium Tuberculosis.
ChainB
Resolution1.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H89
Catalytic site (residue number reindexed from 1) H76
Enzyme Commision number 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 TP6 B A113 N114 R128 K138 A100 N101 R115 K125 MOAD: Ka=474900M^-1
PDBbind-CN: -logKd/Ki=5.68,Kd=2.11uM
BS02 TP6 B W27 G58 A59 I60 E61 V81 V82 I83 G85 Q86 T87 W14 G45 A46 I47 E48 V68 V69 I70 G72 Q73 T74 MOAD: Ka=474900M^-1
PDBbind-CN: -logKd/Ki=5.68,Kd=2.11uM
Gene Ontology
Molecular Function
GO:0000906 6,7-dimethyl-8-ribityllumazine synthase activity
GO:0016740 transferase activity
Biological Process
GO:0009231 riboflavin biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0009349 riboflavin synthase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2c92, PDBe:2c92, PDBj:2c92
PDBsum2c92
PubMed16984393
UniProtP9WHE9|RISB_MYCTU 6,7-dimethyl-8-ribityllumazine synthase (Gene Name=ribH)

[Back to BioLiP]