Structure of PDB 2c7a Chain B

Receptor sequence
>2c7aB (length=76) Species: 9606 (Homo sapiens) [Search protein sequence]
PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVD
KIRRKNCPACRLRKCCQAGMVLGGRK
3D structure
PDB2c7a Structure of the Progesterone Receptor-Deoxyribonucleic Acid Complex: Novel Interactions Required for Binding to Half-Site Response Elements.
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S586 R593 R616 R623 K638 S24 R31 R54 R61 K76 PDBbind-CN: Kd=133nM
BS02 dna B C577 H578 Y579 K588 K592 K617 G636 R637 C15 H16 Y17 K26 K30 K55 G74 R75 PDBbind-CN: Kd=133nM
BS03 ZN B C567 C570 C584 C587 C5 C8 C22 C25
BS04 ZN B C603 C609 C619 C622 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2c7a, PDBe:2c7a, PDBj:2c7a
PDBsum2c7a
PubMed16931575
UniProtP06401|PRGR_HUMAN Progesterone receptor (Gene Name=PGR)

[Back to BioLiP]