Structure of PDB 2c06 Chain B |
>2c06B (length=110) Species: 562 (Escherichia coli) [Search protein sequence] |
MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGN FARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNE VLGRLSTILT |
|
PDB | 2c06 Model for RNA Binding and the Catalytic Site of the Rnase Kid of the Bacterial Pard Toxin-Antitoxin System. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B |
T37 R38 K83 |
T37 R38 K83 |
|
|
|
|