Structure of PDB 2bwg Chain B

Receptor sequence

>2bwgB (length=329) Species: 9606 (Homo sapiens)

PRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPII
VANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAV
SSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPE
HTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSA
VIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTEC
AGEVIRKLKLFYGMSSDTAMNKHVAEYRASEGKTVEVPYKGDVENTILDI
LGGLRSTCTYVGAAKLKELSRRATFIRVT

3D structure

• PDB: 2bwg Structure of Human Guanosine Monophosphate Reductase Gmpr1 in Complex with Gmp
• Chain: B
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K13 I48 P49
• Catalytic site (residue number reindexed from 1): K12 I47 P48
• Enzyme Commision number: 1.7.1.7: GMP reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	5GP	B	M55 G183 S184 C186 D219 G220 G221 G243 G268 M269 S270 R286 S288 G290	M54 G182 S183 C185 D218 G219 G220 G242 G263 M264 S265 R278 S280 G282

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0003920 GMP reductase activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0006163 purine nucleotide metabolic process
• GO:0009117 nucleotide metabolic process
• GO:0009409 response to cold

Cellular Component

• GO:0005829 cytosol
• GO:1902560 GMP reductase complex

External links

• PDB: RCSB:2bwg, PDBe:2bwg, PDBj:2bwg
• PDBsum: 2bwg
• UniProt: P36959|GMPR1_HUMAN GMP reductase 1 (Gene Name=GMPR)