Structure of PDB 2bwc Chain B

Receptor sequence

>2bwcB (length=226) Species: 29549 (Rhodothermus marinus)

TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHD
NGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRW
NAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGAT
WEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHA
VETGFELWEGGAGLRSADFSVTVQKL

3D structure

• PDB: 2bwc Dimerisation and an increase in active site aromatic groups as adaptations to high temperatures: X-ray solution scattering and substrate-bound crystal structures of Rhodothermus marinus endoglucanase Cel12A.
• Chain: B
• Resolution: 2.15 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E124 E207
• Catalytic site (residue number reindexed from 1): E123 E206
• Enzyme Commision number: 3.2.1.4: cellulase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	B	W26 Y59 E124 W161 E207	W25 Y58 E123 W160 E206
BS02	BGC	B	N24 W26 H67 W68	N23 W25 H66 W67
BS03	BGC	B	W9 H67	W8 H66
BS04	GLC	B	P137 G138 W159 Y163 E207	P136 G137 W158 Y162 E206

Gene Ontology

Molecular Function

• GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
• GO:0008810 cellulase activity

Biological Process

• GO:0000272 polysaccharide catabolic process

External links

• PDB: RCSB:2bwc, PDBe:2bwc, PDBj:2bwc
• PDBsum: 2bwc
• PubMed: 16343530
• UniProt: O33897