Structure of PDB 2bt9 Chain B

Receptor sequence
>2bt9B (length=88) Species: 305 (Ralstonia solanacearum) [Search protein sequence]
SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSV
TSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTS
3D structure
PDB2bt9 The fucose-binding lectin from Ralstonia solanacearum. A new type of beta-propeller architecture formed by oligomerization and interacting with fucoside, fucosyllactose, and plant xyloglucan.
ChainB
Resolution0.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MFU B I16 W31 W36 I16 W31 W36 MOAD: Kd=0.64uM
BS02 MFU B R17 E28 G39 A40 W76 W81 R17 E28 G39 A40 W76 W81 MOAD: Kd=0.64uM
BS03 MFU B R62 E73 G84 A85 R62 E73 G84 A85 MOAD: Kd=0.64uM
External links