Structure of PDB 2brq Chain B

Receptor sequence
>2brqB (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISF
EDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP
3D structure
PDB2brq The Molecular Basis of Filamin Binding to Integrins and Competition with Talin.
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B G2269 L2271 A2272 I2273 A2274 V2275 E2276 G2277 P2278 S2279 K2280 A2281 I2283 F2285 G34 L36 A37 I38 A39 V40 E41 G42 P43 S44 K45 A46 I48 F50
BS02 GSH B F2285 E2286 D2287 G2291 S2292 C2293 F50 E51 D52 G56 S57 C58
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2brq, PDBe:2brq, PDBj:2brq
PDBsum2brq
PubMed16455489
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]