Structure of PDB 2bp3 Chain B

Receptor sequence

>2bp3B (length=90) Species: 9606 (Homo sapiens)

CGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTD
NQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTG

3D structure

• PDB: 2bp3 The Structure of the Gpib-Filamin a Complex.
• Chain: B
• Resolution: 2.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E1895 G1896 G1897 L1898 S1899 L1900 A1901 I1902 E1903 G1904 P1905 S1906 K1907 A1908 I1910 Y1938 G1954	E31 G32 G33 L34 S35 L36 A37 I38 E39 G40 P41 S42 K43 A44 I46 Y74 G90
BS02	peptide	B	G1866 T1869 Y1871 G1872 H1942 P1944 G1945 F1948	G2 T5 Y7 G8 H78 P80 G81 F84

Gene Ontology

Molecular Function

• GO:0051015 actin filament binding

Biological Process

• GO:0030036 actin cytoskeleton organization

External links

• PDB: RCSB:2bp3, PDBe:2bp3, PDBj:2bp3
• PDBsum: 2bp3
• PubMed: 16293600
• UniProt: P21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)